discontinued

H00053339-M01 BTBD1 antibody

See related secondary antibodies

Search for all "BTBD1"

Quick Overview

Mouse anti Human BTBD1 3E11

H00053339-M01

More Views

  • H00053339-M01

Product Description for BTBD1

Mouse anti Human BTBD1 3E11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for BTBD1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms BTB/POZ domain-containing protein 1, C15orf1, HCV NS5A-transactivated protein 8, Hepatitis C virus NS5A-transactivated protein 8, NS5ATP8
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0C5
Immunogen:
BTBD1 (NP_079514, 384 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFF SSPGNNNGTSIEDGQIPEIIFYT*
GeneID:
53339
Remarks:
Gene Accession: NM_025238
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant BTBD1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 53339

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD1 (4 products)

Catalog No. Species Pres. Purity   Source  

BTBD1

BTBD1 Human Purified
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human Purified
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BTBD1

BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BTBD1 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD1 overexpression lysate

BTBD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn