TA335449 BTBD1 antibody

Rabbit Polyclonal Anti-BTBD1 Antibody

See related secondary antibodies

Search for all "BTBD1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat BTBD1


More Views

  • TA335449
  • TA335449
  • TA335449

Product Description for BTBD1

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat BTBD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BTB/POZ domain-containing protein 1, C15orf1, HCV NS5A-transactivated protein 8, Hepatitis C virus NS5A-transactivated protein 8, NS5ATP8
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-BTBD1 Antibody: synthetic peptide directed towards the N terminal of human BTBD1. Synthetic peptide located within the following region: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP.
Application WB
Background The C-terminus of BTBD1 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Altertive splicing results in multiple transcript variants encoding different isoforms.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD1 (4 products)

Catalog No. Species Pres. Purity   Source  


BTBD1 Human Purified
  Abnova Taiwan Corp.


BTBD1 Human Purified
  Abnova Taiwan Corp.


BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


BTBD1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BTBD1 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)

BTBD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD1 overexpression lysate

BTBD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn