H00388419-B01P BTBD17 antibody

See related secondary antibodies

Search for all "BTBD17"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human BTBD17

H00388419-B01P

Product Description for BTBD17

Mouse anti Human BTBD17.
Product is tested for Western blot / Immunoblot.

Properties for BTBD17

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms BTBD17A, LGALS3BPL
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NE02
Immunogen:
BTBD17 (AAI68374.1, 1 a.a. ~ 478 a.a) full-length human protein.
AA Sequence:
MPRRGYSKPGSWGSFWAMLTLVGLVTHAAQRADVGGEAAGTSINHSQAVLQRLQELLRQGNASDVVLRVQAAGTDE VRVFHAHRLLLGLHSELFLELLSNQSEAVLQEPQDCAAVFDKFIRYLYCGELTVLLTQAIPLHRLATKYGVSSLQR GVADYMRAHLAGGAGPAVGWYHYAVGTGDEALRESCLQFLAWNLSAVAASTEWGAVSPELLWQLLQRSDLVLQDEL ELFHALEAWLGRARPPPAVAERALRAIRYPMIPPAQLFQLQARSAALARHGPAVADLLLQAYQFHAASPLHYAKFF DVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSPRWLPVSLRPVYADAAGTA LPAARPEDGRPRLVVTPASSGGDAAGVSFQKTVLVGARQQGRLLVRHAYSFHQSSEEAGDFLAHADLQRRNSEYLV ENALHLHLIVKPVYHTLIRTPK
GeneID:
388419
Add. information Mouse polyclonal antibody raised against a full-length human BTBD17 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD17 (1 products)

Catalog No. Species Pres. Purity   Source  

BTB (POZ) domain containing 17 (BTBD17)

BTB (POZ) domain containing 17 (BTBD17) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for BTBD17 (1 products)

Catalog No. Species Pres. Purity   Source  

BTBD17 overexpression lysate

BTBD17 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn