NBP1-90749 BTBD17 antibody

See related secondary antibodies

Search for all "BTBD17"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human BTBD17

Product Description for BTBD17

Rabbit anti Human BTBD17.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for BTBD17

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NE02
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VADLLLQAYQFHAASPLHYAKFFDVNGSAFLPRNYLAPAWGAPWVINNPARDDRSTSFQTQLGPSGHDAGRRVTWNVLFSPRWLPVSLRPV
GeneID:
388419
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 388419

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD17 (1 products)

Catalog No. Species Pres. Purity   Source  

BTB (POZ) domain containing 17 (BTBD17)

BTB (POZ) domain containing 17 (BTBD17) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for BTBD17 (1 products)

Catalog No. Species Pres. Purity   Source  

BTBD17 overexpression lysate

BTBD17 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn