NBP1-70423 BTF3L3 antibody

See related secondary antibodies

Search for all "BTF3L3"

Quick Overview

Rabbit anti Human BTF3L3

Product Description for BTF3L3

Rabbit anti Human BTF3L3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3L3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BTF3L3(basic transcription factor 3, like 3) The peptide sequence was selected from the middle region of BTF3L3. Peptide sequence CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK.
Background BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn