NBP1-70423 BTF3L3 antibody

See related secondary antibodies

Search for all "BTF3L3"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human BTF3L3

Product Description for BTF3L3

Rabbit anti Human BTF3L3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3L3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6LDD8
Immunogen:
Synthetic peptides corresponding to BTF3L3(basic transcription factor 3, like 3) The peptide sequence was selected from the middle region of BTF3L3. Peptide sequence CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK.
Background BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn