
TA339057 BTF3P11 antibody

Rabbit Polyclonal Anti-BTF3P11 Antibody

See related secondary antibodies

Search for all "BTF3P11"

Quick Overview

Rabbit anti Human BTF3P11

Product Description for BTF3P11

Rabbit anti Human BTF3P11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3P11

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

The immunogen for anti-BTF3L1 antibody: synthetic peptide directed towards the n terminal of human BTF3L1. Synthetic peptide located within the following region: MKETIMNQKLTKRQAEVHTGRKGTAHRKKVVHTTAEDKKFQFSLKKLGVN.
Application WB
Background BTF3L1 is a putative member of the BTF3 family of transcription factors. Transcription of this gene has not yet been documented.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn