discontinued

TA344366 BTF3P13 antibody

See related secondary antibodies

Search for all "BTF3P13"

50 µg / €325.00

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish BTF3P13

TA344366

Product Description for BTF3P13

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish BTF3P13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3P13

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Immunogen:
The immunogen for anti-BTF3L3 antibody: synthetic peptide directed towards the middle region of human BTF3L3. Synthetic peptide located within the following region: CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK.
GeneID:
132556
Application WB
Background BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn