
TA344366 BTF3P13 antibody

Rabbit Polyclonal Anti-BTF3L3 Antibody - middle region

See related secondary antibodies

Search for all "BTF3P13"

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish BTF3P13


Product Description for BTF3P13

Rabbit anti Bovine, Human, Mouse, Rat, Zebrafish BTF3P13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTF3P13

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

The immunogen for anti-BTF3L3 antibody: synthetic peptide directed towards the middle region of human BTF3L3. Synthetic peptide located within the following region: CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK.
Application WB
Background BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn