
NBP1-58206 Bub3 antibody

See related secondary antibodies

Search for all "Bub3"

Quick Overview

Rabbit anti Bovine, Chicken, Human, Mouse, Rat, Xenopus Bub3

Product Description for Bub3

Rabbit anti Bovine, Chicken, Human, Mouse, Rat, Xenopus Bub3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Bub3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BUB3L, hBUB3
Presentation Aff - Purified
Reactivity Bov, Chk, Hu, Ms, Rt, Xen
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BUB3(BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)) The peptide sequence was selected from the N terminal of BUB3. Peptide sequence MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR.
Background BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 9184

Accessory Products

  • LinkedIn