TA344273 BUB3 antibody

Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region

See related secondary antibodies

Search for all "BUB3"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BUB3

TA344273

More Views

  • TA344273
  • TA344273

Product Description for BUB3

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat BUB3.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for BUB3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Mitotic checkpoint protein BUB3
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43684
Immunogen:
The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR.
GeneID:
9184
Application WB
IF
Background BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BUB3 (5 products)

Catalog No. Species Pres. Purity   Source  

BUB3 (transcript variant 2)

BUB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

BUB3 (1-328, His-tag)

BUB3 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  OriGene Technologies GmbH

BUB3 (1-328, His-tag)

BUB3 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

BUB3

BUB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BUB3

BUB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BUB3 (2 products)

Catalog No. Species Pres. Purity   Source  

Bub3 Lysate

Western Blot: Bub3 Lysate [NBL1-08058] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BUB3 Protein
  Novus Biologicals Inc.

BUB3 overexpression lysate

BUB3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn