NBP1-88738 C10orf107 antibody

See related secondary antibodies

Search for all "C10orf107"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C10orf107

Product Description for C10orf107

Rabbit anti Human C10orf107.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf107

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVU9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
GeneID:
219621
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 219621

Accessory Products

Proteins and/or Positive Controls

Positive controls for C10orf107 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf107 Lysate

Western Blot: C10orf107 Lysate [NBL1-08069] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C10orf107 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn