discontinued

NBP1-88738 C10orf107 antibody

See related secondary antibodies

Search for all "C10orf107"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C10orf107

Product Description for C10orf107

Rabbit anti Human C10orf107.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf107

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVU9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIE
GeneID:
219621
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 219621

Accessory Products

Proteins and/or Positive Controls

Positive controls for C10orf107 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf107 Lysate

Western Blot: C10orf107 Lysate [NBL1-08069] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C10orf107 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn