H00221060-B01P C10orf111 antibody

See related secondary antibodies

Search for all "C10orf111"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C10orf111

H00221060-B01P

Product Description for C10orf111

Mouse anti Human C10orf111.
Product is tested for Western blot / Immunoblot.

Properties for C10orf111

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC35468, bA455B2.4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N326
Immunogen:
C10orf111 (ADZ15789.1, 1 a.a. ~ 155 a.a) full-length human protein.
AA Sequence:
MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESL QSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSY FLV
GeneID:
221060
Add. information Mouse polyclonal antibody raised against a full-length human C10orf111 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf111 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 10 open reading frame 111 (C10orf111)

Chromosome 10 open reading frame 111 (C10orf111) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C10orf111 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf111 Lysate

Western Blot: C10orf111 Lysate [NBL1-08070] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C10orf111 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C10orf111 overexpression lysate

C10orf111 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn