NBP1-91709 C10orf111 antibody

See related secondary antibodies

Search for all "C10orf111"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C10orf111

Product Description for C10orf111

Rabbit anti Human C10orf111.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf111

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N326
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSV
GeneID:
221060
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 221060

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf111 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 10 open reading frame 111 (C10orf111)

Chromosome 10 open reading frame 111 (C10orf111) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C10orf111 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf111 Lysate

Western Blot: C10orf111 Lysate [NBL1-08070] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C10orf111 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C10orf111 overexpression lysate

C10orf111 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn