discontinued

NBP1-86317 C10orf35 antibody

See related secondary antibodies

Search for all "C10orf35"

Quick Overview

Rabbit anti Human C10orf35

Product Description for C10orf35

Rabbit anti Human C10orf35.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf35

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96D05
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
GeneID:
219738
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 219738

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf35 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 10 open reading frame 35 (C10orf35)

Chromosome 10 open reading frame 35 (C10orf35) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C10orf35 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf35 Lysate

Western Blot: C10orf35 Lysate [NBL1-08077] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C10orf35 Protein
  Novus Biologicals Inc.
  • LinkedIn