H00414157-B01P C10orf62 antibody

See related secondary antibodies

Search for all "C10orf62"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C10orf62

H00414157-B01P

Product Description for C10orf62

Mouse anti Human C10orf62.
Product is tested for Western blot / Immunoblot.

Properties for C10orf62

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms bA548K23.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T681
Immunogen:
C10orf62 (NP_001009997.1, 1 a.a. ~ 223 a.a) full-length human protein.
AA Sequence:
MLWVQRKRRRKETSECPSDKDKSPESHKAKNESWIKSHFSRLSEEKLALDNNASASGNATQTESGSEEVSSTVHIE TFTTRHGEVGSALHRESFTSRQKTSGPSVIQEIHQESGKAPSTDDATWAAVAACTKEIDTQGRHLAHSMLQRAIAY QHSGHLESKDINQEELRALEEVEMKLQKNFLTQRENTIAGANHTHTFYGHSHHSHHGHPSHQSHSLPNRRH
GeneID:
414157
Add. information Mouse polyclonal antibody raised against a full-length human C10orf62 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C10orf62 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf62 overexpression lysate

C10orf62 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn