H00196740-B01P C10orf72 antibody

See related secondary antibodies

Search for all "C10orf72"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C10orf72

H00196740-B01P

Product Description for C10orf72

Mouse anti Human C10orf72.
Product is tested for Western blot / Immunoblot.

Properties for C10orf72

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ31737, MGC44086
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IW00
Immunogen:
C10orf72 (NP_001026916.1, 1 a.a. ~ 320 a.a) full-length human protein.
AA Sequence:
MRLLALAAAALLARAPAPEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAVRWFFAHSSDSQEALMV KMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPSDQGHYVCRVQEISRHRNKWTAWSNGSSATEMR VISLKASEESSFEKTKETWAFFEDLYVYAVLVCCVGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGETV TSVTSLAPLQPKKGRRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRAAKGA PTSTVYAQILFEENKL
GeneID:
196740
Add. information Mouse polyclonal antibody raised against a full-length human C10orf72 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C10orf72 (2 products)

Catalog No. Species Pres. Purity   Source  

VSTM4 overexpression lysate

VSTM4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

VSTM4 overexpression lysate

VSTM4 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn