H00170393-B01P C10orf91 antibody

See related secondary antibodies

Search for all "C10orf91"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C10orf91

H00170393-B01P

Product Description for C10orf91

Mouse anti Human C10orf91.
Product is tested for Western blot / Immunoblot.

Properties for C10orf91

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms RP11-432J24.4, bA432J24.4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T1B1
Immunogen:
C10orf91 (NP_775812.1, 1 a.a. ~ 145 a.a) full-length human protein.
AA Sequence:
MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTT RALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
GeneID:
170393
Add. information Mouse polyclonal antibody raised against a full-length human C10orf91 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf91 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf91

C10orf91 Human
10 µg / €380.00
  Abnova Taiwan Corp.

C10orf91

C10orf91 Human
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for C10orf91 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf91 overexpression lysate

C10orf91 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn