discontinued

H00170393-B01P C10orf91 antibody

See related secondary antibodies

Search for all "C10orf91"

Quick Overview

Mouse anti Human C10orf91

H00170393-B01P

Product Description for C10orf91

Mouse anti Human C10orf91.
Product is tested for Western blot / Immunoblot.

Properties for C10orf91

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms RP11-432J24.4, bA432J24.4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T1B1
Immunogen:
C10orf91 (NP_775812.1, 1 a.a. ~ 145 a.a) full-length human protein.
AA Sequence:
MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQPQTT RALSLRQPQHPSAPASGRPRPPHSSGPDLAEAAPVVDQASQAAGRASSGLGLWEQASVSQGFRNAAFEA
GeneID:
170393
Add. information Mouse polyclonal antibody raised against a full-length human C10orf91 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf91 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf91

C10orf91 Human
  Abnova Taiwan Corp.

C10orf91

C10orf91 Human
  Abnova Taiwan Corp.

Positive controls for C10orf91 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf91 overexpression lysate

C10orf91 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn