NBP1-90790 C10orf91 antibody

See related secondary antibodies

Search for all "C10orf91"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C10orf91

Product Description for C10orf91

Rabbit anti Human C10orf91.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf91

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T1B1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQ
GeneID:
170393
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 170393

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf91 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf91

C10orf91 Human
10 µg / €380.00
  Abnova Taiwan Corp.

C10orf91

C10orf91 Human
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for C10orf91 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf91 overexpression lysate

C10orf91 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn