discontinued

NBP1-90790 C10orf91 antibody

See related secondary antibodies

Search for all "C10orf91"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C10orf91

Product Description for C10orf91

Rabbit anti Human C10orf91.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf91

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T1B1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQ
GeneID:
170393
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 170393

Accessory Products

Proteins and/or Positive Controls

Proteins for C10orf91 (2 products)

Catalog No. Species Pres. Purity   Source  

C10orf91

C10orf91 Human
10 µg / €380.00
  Abnova Taiwan Corp.

C10orf91

C10orf91 Human
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for C10orf91 (1 products)

Catalog No. Species Pres. Purity   Source  

C10orf91 overexpression lysate

C10orf91 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn