NBP1-90773 C10orf93 antibody

See related secondary antibodies

Search for all "C10orf93"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C10orf93

Product Description for C10orf93

Rabbit anti Human C10orf93.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C10orf93

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SR76
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LAPDAFQIVLDSENEAKVSTGKNRGRFTYLCAKAWHHTVSVDKAAGHLRRLGNENDKERIQIWAELAKVARKQ
GeneID:
54777
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 255352

Accessory Products

  • LinkedIn