H00025858-B01P C11orf20 antibody

See related secondary antibodies

Search for all "C11orf20"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C11orf20

H00025858-B01P

Product Description for C11orf20

Mouse anti Human C11orf20.
Product is tested for Western blot / Immunoblot.

Properties for C11orf20

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp566E164
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NTU4
Immunogen:
C11orf20 (CAL37866.1, 1 a.a. ~ 200 a.a) full-length human protein.
AA Sequence:
MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEG YKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMEL MENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
GeneID:
25858
Add. information Mouse polyclonal antibody raised against a full-length human C11orf20 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C11orf20 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 11 open reading frame 20 (C11orf20)

Chromosome 11 open reading frame 20 (C11orf20) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C11orf20 (1 products)

Catalog No. Species Pres. Purity   Source  

TEX40 overexpression lysate

TEX40 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn