H00219833-B01P C11orf45 antibody

See related secondary antibodies

Search for all "C11orf45"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C11orf45

H00219833-B01P

Product Description for C11orf45

Mouse anti Human C11orf45.
Product is tested for Western blot / Immunoblot.

Properties for C11orf45

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ43646, MGC35558
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAV5
Immunogen:
C11orf45 (NP_659450.1, 1 a.a. ~ 145 a.a) full-length human protein.
AA Sequence:
MLTRLVLSAHLSSTTSPPWTHAAISWELDNVLMPSPRIWPQVTPTGRSASVRSEGNTSSLWNFSAGQDVHAIVTRT CESVLSSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
GeneID:
219833
Add. information Mouse polyclonal antibody raised against a full-length human C11orf45 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C11orf45 (1 products)

Catalog No. Species Pres. Purity   Source  

C11orf45 Lysate

Western Blot: C11orf45 Lysate [NBL1-08101] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C11orf45 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn