H00144097-B01P C11orf84 antibody

See related secondary antibodies

Search for all "C11orf84"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C11orf84

H00144097-B01P

Product Description for C11orf84

Mouse anti Human C11orf84.
Product is tested for Western blot / Immunoblot.

Properties for C11orf84

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp762N0114
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUA3
Immunogen:
C11orf84 (NP_612480.1, 1 a.a. ~ 381 a.a) full-length human protein.
AA Sequence:
MALKAEGAALDCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQE FLVGSSPGGSGRALCMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNS DSGQDAHPDPDANPDAARMPAEIVVLLDSEDNPSLPKRSRPRGLRPLELPAVPATEPGNKKPRGQRWKEPPGEEPV RKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSFPAGFVLQLFSHTQLRGPDSKDSPKDREVAEGGLP RAESPSPAPPPGLRGTLDLQVIRVRMEEPPAVSLLQDWSRHPQGTKRVGAGDTSDWPTVLSESSTTVAGKPEKGNG V
GeneID:
144097
Add. information Mouse polyclonal antibody raised against a full-length human C11orf84 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C11orf84 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 11 open reading frame 84 (C11orf84)

Chromosome 11 open reading frame 84 (C11orf84) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C11orf84 (2 products)

Catalog No. Species Pres. Purity   Source  

C11orf84 Lysate

Western Blot: C11orf84 Lysate [NBL1-12576] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C11orf84
0.1 mg / €400.00
  Novus Biologicals Inc.

C11orf84 overexpression lysate

C11orf84 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn