H00196477-B01P C12orf12 antibody

See related secondary antibodies

Search for all "C12orf12"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C12orf12

H00196477-B01P

Product Description for C12orf12

Mouse anti Human C12orf12.
Product is tested for Western blot / Immunoblot.

Properties for C12orf12

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC26598
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TC90
Immunogen:
C12orf12 (NP_689851.1, 1 a.a. ~ 406 a.a) full-length human protein.
AA Sequence:
MTQTLDTREDPLNLGGGGGGGCGCGWAHSASLSSWSSCHRRRPGAPAYNRPHRYSPKTEYGPPRKQPKQQHGPGFW FQPPVCSNWGCWGGPWRPPPPGFWKFPCPVQVFRVYGLHPLCFCCCSCWSGSWNPGWVKPPGRKKRWGRRGRGLRH HPRHSYPRSPPADVSTLPRPVKLYEWREPGMRAPPNTTQFIMNQIYEDMRQQEKVERQQEALRAQKATVSGEASPA RSSGNDAPPGGSKETWGLQETLYGFVQNPSLAFSPNPEENQSLAPLLVEEEEEKKNDDEEEYDQEVCDAKEASEEE EEVEDEEEEVEDEEEEEVEEAEYVEEGEEELEEEELEEEEEVLEENEQRGEEFHLPLEMPLSIFVEAEEKRENFIS CTFLNPEQIIPKVPQESLFMAQDFNC
GeneID:
196477
Add. information Mouse polyclonal antibody raised against a full-length human C12orf12 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C12orf12 (2 products)

Catalog No. Species Pres. Purity   Source  

C12orf12 Lysate

Western Blot: C12orf12 Lysate [NBL1-08128] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for C12orf12. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

CCER1 overexpression lysate

CCER1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn