H00083695-B01P C12orf32 antibody

See related secondary antibodies

Search for all "C12orf32"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C12orf32

H00083695-B01P

Product Description for C12orf32

Mouse anti Human C12orf32.
Product is tested for Western blot / Immunoblot.

Properties for C12orf32

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HKMT1188, MGC13204
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BSD3
Immunogen:
C12orf32 (NP_113653.1, 1 a.a. ~ 238 a.a) full-length human protein.
AA Sequence:
MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQ NRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVF IPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGK LSRSQFLVKS
GeneID:
83695
Add. information Mouse polyclonal antibody raised against a full-length human C12orf32 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn