discontinued

NBP1-93474 C12orf45 antibody

See related secondary antibodies

Search for all "C12orf45"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C12orf45

Product Description for C12orf45

Rabbit anti Human C12orf45.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C12orf45

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5I9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LINSQPKSRKTSTLQTVRIERSPLLDQVQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEMNQSDSKEVD
GeneID:
121053
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 121053

Accessory Products

  • LinkedIn