H00084934-B01P C12orf52 antibody

See related secondary antibodies

Search for all "C12orf52"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C12orf52

H00084934-B01P

Product Description for C12orf52

Mouse anti Human C12orf52.
Product is tested for Western blot / Immunoblot.

Properties for C12orf52

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ14827
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96K30
Immunogen:
C12orf52 (NP_116237.1, 1 a.a. ~ 269 a.a) full-length human protein.
AA Sequence:
MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALGA KGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRALLWTPPPTPRGSH SPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRP STSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK
GeneID:
84934
Add. information Mouse polyclonal antibody raised against a full-length human C12orf52 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C12orf52 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 12 open reading frame 52 (C12orf52)

Chromosome 12 open reading frame 52 (C12orf52) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn