H00144608-B01P C12orf60 antibody

See related secondary antibodies

Search for all "C12orf60"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C12orf60

H00144608-B01P

Product Description for C12orf60

Mouse anti Human C12orf60.
Product is tested for Western blot / Immunoblot.

Properties for C12orf60

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC47869
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5U649
Immunogen:
C12orf60 (NP_787070.1, 1 a.a. ~ 245 a.a) full-length human protein.
AA Sequence:
MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVRNNSYIKDFFEQMLKIFKEMQSVVDA RHDKIQKESLCSKVAMAMCSVVQKSTNVEELHQSAKEVFKSAHTPVIISVLNSSNILGSLESSLSHLMKFPIMNLQ LSDFYTEDTKEQSDVTTSERTRSPPGSSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKA IKTMEMNISVFKKASDK
GeneID:
144608
Add. information Mouse polyclonal antibody raised against a full-length human C12orf60 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C12orf60 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 12 open reading frame 60 (C12orf60)

Chromosome 12 open reading frame 60 (C12orf60) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C12orf60 (2 products)

Catalog No. Species Pres. Purity   Source  

C12orf60 Lysate

Western Blot: C12orf60 Lysate [NBL1-08154] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C12orf60 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C12orf60 overexpression lysate

C12orf60 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn