NBP1-91714 C12orf60 antibody

See related secondary antibodies

Search for all "C12orf60"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C12orf60

Product Description for C12orf60

Rabbit anti Human C12orf60.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C12orf60

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5U649
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD
GeneID:
144608
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 144608

Accessory Products

Proteins and/or Positive Controls

Proteins for C12orf60 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 12 open reading frame 60 (C12orf60)

Chromosome 12 open reading frame 60 (C12orf60) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C12orf60 (2 products)

Catalog No. Species Pres. Purity   Source  

C12orf60 Lysate

Western Blot: C12orf60 Lysate [NBL1-08154] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C12orf60 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C12orf60 overexpression lysate

C12orf60 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn