H00144577-B01P C12orf66 antibody

See related secondary antibodies

Search for all "C12orf66"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C12orf66

H00144577-B01P

Product Description for C12orf66

Mouse anti Human C12orf66.
Product is tested for Western blot / Immunoblot.

Properties for C12orf66

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ32549
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MD2
Immunogen:
C12orf66 (AAH36246.1, 1 a.a. ~ 468 a.a) full-length human protein.
AA Sequence:
MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREADKSAGGSWLSLLAALAHLAAAEKVYHSLTYLGQ KLGGQSFFSRKDSIRTIYTSLHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEIADFYEKMYTLSTQ KFINAEELVGLLDAIMKKYSSRFHHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQ IFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFFGKISSF IRKYDAANVSLIFDNRGSESSQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEK VVHFYDDKVQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLKPGSKGSCYQCNYFVAF CLDYSKLLLQRK
GeneID:
144577
Add. information Mouse polyclonal antibody raised against a full-length human C12orf66 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C12orf66 (1 products)

Catalog No. Species Pres. Purity   Source  

C12orf66 overexpression lysate

C12orf66 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn