H00121793-B01P C13orf16 antibody

See related secondary antibodies

Search for all "C13orf16"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C13orf16

H00121793-B01P

Product Description for C13orf16

Mouse anti Human C13orf16.
Product is tested for Western blot / Immunoblot.

Properties for C13orf16

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC35169, bA474D23.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6K0
Immunogen:
C13orf16 (NP_689537.1, 1 a.a. ~ 151 a.a) full-length human protein.
AA Sequence:
MEYVLEVKNSPRHLLKQFTVCDVPLYDICDYNVSRDRCQELGCCFYEGVCYKKAVPIYIHVFSALIVIIAGAFVIT IIYRVIQESRKEKAIPVDVALPQKSSEKAELASSSSKLGLKPASPGPPSAGPSMKSDEDKDDVTGTITEAEETED
GeneID:
121793
Add. information Mouse polyclonal antibody raised against a full-length human C13orf16 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C13orf16 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 13 open reading frame 16 (C13orf16)

Chromosome 13 open reading frame 16 (C13orf16) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C13orf16 (2 products)

Catalog No. Species Pres. Purity   Source  

C13orf16 Lysate

Western Blot: C13orf16 Lysate [NBL1-08158] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C13orf16 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

TEX29 overexpression lysate

TEX29 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn