TA333612 C14orf142 antibody

Rabbit Polyclonal Anti-C14orf142 Antibody

See related secondary antibodies

Search for all "C14orf142"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat C14orf142

Product Description for C14orf142

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat C14orf142.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C14orf142

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-C14orf142 Antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf142. Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for C14orf142 (1 products)

Catalog No. Species Pres. Purity   Source  


C14orf142 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C14orf142 (2 products)

Catalog No. Species Pres. Purity   Source  

C14orf142 overexpression lysate

C14orf142 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DCTN5 Lysate

Western Blot: DCTN5 Lysate [NBL1-08176] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C14orf142 Protein
  Novus Biologicals Inc.
  • LinkedIn