discontinued

H00084800-B01P C14orf151 purified MaxPab mouse antibody

See related secondary antibodies

Search for all "C14orf151 purified MaxPab mouse"

50 µg / €370.00

Quick Overview

Mouse anti Human C14orf151 purified MaxPab mouse

H00084800-B01P

Product Description for C14orf151 purified MaxPab mouse

Mouse anti Human C14orf151 purified MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for C14orf151 purified MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC13251, chromosome 14 open reading frame 151
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
C14orf151 (NP_116103, 1 a.a. ~ 234 a.a) full-length human protein.
AA Sequence:
MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLEQSGLDL LLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCI YSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLD VLARLR
Remarks:
Gene Accession: NM_032714
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
State:
Purified

Accessory Products

  • LinkedIn