
TA335927 C14orf184 antibody

Rabbit Polyclonal Anti-C14orf184 Antibody

See related secondary antibodies

Search for all "C14orf184"

Quick Overview

Rabbit anti Human C14orf184

Product Description for C14orf184

Rabbit anti Human C14orf184.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C14orf184

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-C14orf184 Antibody is: synthetic peptide directed towards the N-terminal region of Human C14orf184. Synthetic peptide located within the following region: GEQELGSWRERANSTPERRLSPALKHVSARPTSIPETPGERGARTRRDRA.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn