discontinued

NBP1-82308 C14orf93 antibody

See related secondary antibodies

Search for all "C14orf93"

Quick Overview

Rabbit anti Human C14orf93

Product Description for C14orf93

Rabbit anti Human C14orf93.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C14orf93

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H972
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGEAFKALSAVEEECDSVGSGVQVVIEELRQLGAASVGPGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDDYVASEGAVQRVLVPAYAKQLSPATQLAIQRATPETGPENGTKL
GeneID:
60686
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 60686

Accessory Products

Proteins and/or Positive Controls

Positive controls for C14orf93 (1 products)

Catalog No. Species Pres. Purity   Source  

C14orf93 Lysate

Western Blot: C14orf93 Lysate [NBL1-08196] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C14orf93 Protein
  Novus Biologicals Inc.
  • LinkedIn