H00348110-B01P C15orf38 antibody

See related secondary antibodies

Search for all "C15orf38"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C15orf38

H00348110-B01P

Product Description for C15orf38

Mouse anti Human C15orf38.
Product is tested for Western blot / Immunoblot.

Properties for C15orf38

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC61550
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6K5
Immunogen:
C15orf38 (NP_872422.1, 1 a.a. ~ 226 a.a) full-length human protein.
AA Sequence:
MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKFDA KGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEMEVMEL ELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD
GeneID:
348110
Add. information Mouse polyclonal antibody raised against a full-length human C15orf38 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf38 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 15 open reading frame 38 (C15orf38)

Chromosome 15 open reading frame 38 (C15orf38) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C15orf38 (1 products)

Catalog No. Species Pres. Purity   Source  

ARPIN overexpression lysate

ARPIN overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn