H00145645-B01P C15orf43 antibody

See related secondary antibodies

Search for all "C15orf43"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C15orf43

H00145645-B01P

Product Description for C15orf43

Mouse anti Human C15orf43.
Product is tested for Western blot / Immunoblot.

Properties for C15orf43

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC33951
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHR7
Immunogen:
C15orf43 (NP_689661.1, 1 a.a. ~ 220 a.a) full-length human protein.
AA Sequence:
MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAK IKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIR TPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK
GeneID:
145645
Add. information Mouse polyclonal antibody raised against a full-length human C15orf43 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf43 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 15 open reading frame 43 (C15orf43), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 15 open reading frame 43 (C15orf43), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C15orf43 (2 products)

Catalog No. Species Pres. Purity   Source  

C15orf43 Lysate

Western Blot: C15orf43 Lysate [NBL1-08205] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C15orf43 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C15orf43 overexpression lysate

C15orf43 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn