NBP1-81106 C15orf43 antibody

See related secondary antibodies

Search for all "C15orf43"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C15orf43

Product Description for C15orf43

Rabbit anti Human C15orf43.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C15orf43

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NHR7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAKIKNSVALGHFILPPACLQ
GeneID:
145645
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 145645

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf43 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 15 open reading frame 43 (C15orf43), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 15 open reading frame 43 (C15orf43), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C15orf43 (2 products)

Catalog No. Species Pres. Purity   Source  

C15orf43 Lysate

Western Blot: C15orf43 Lysate [NBL1-08205] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C15orf43 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C15orf43 overexpression lysate

C15orf43 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn