discontinued

H00090416-B01P C15orf57 antibody

See related secondary antibodies

Search for all "C15orf57"

0.5 mg / €1,400.00

Quick Overview

Mouse anti Human C15orf57

H00090416-B01P

Product Description for C15orf57

Mouse anti Human C15orf57.
Product is tested for Western blot / Immunoblot.

Properties for C15orf57

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms CCDC32, FLJ25915, MGC20481
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BV29
Immunogen:
C15orf57 (NP_443081.1, 1 a.a. ~ 185 a.a) full-length human protein.
AA Sequence:
MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEV YLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFKRWLQPDKVAVST EEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ
GeneID:
90416
Add. information Mouse polyclonal antibody raised against a full-length human C15orf57 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf57 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 15 open reading frame 57 (C15orf57), transcript variant 2 (transcript variant 2)

Chromosome 15 open reading frame 57 (C15orf57), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn