NBP1-91218 C15orf57 antibody

See related secondary antibodies

Search for all "C15orf57"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C15orf57

Product Description for C15orf57

Rabbit anti Human C15orf57.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C15orf57

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BV29
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GSGLRFQMKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKL
GeneID:
90416
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 90416

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf57 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 15 open reading frame 57 (C15orf57), transcript variant 2 (transcript variant 2)

Chromosome 15 open reading frame 57 (C15orf57), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn