H00146325-B01P C16orf11 antibody

See related secondary antibodies

Search for all "C16orf11"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C16orf11

H00146325-B01P

Product Description for C16orf11

Mouse anti Human C16orf11.
Product is tested for Western blot / Immunoblot.

Properties for C16orf11

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96S23
Immunogen:
C16orf11 (NP_660313.1, 1 a.a. ~ 571 a.a) full-length human protein.
AA Sequence:
MSREAGSCRVGTGARARSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLDSPDWAC RRGSTTPRPHAPTPDRPGESDPGRQPQGARPTGAAPAPDLVVADIHSLHCGGGPKSRAKGSPGPPPPVARATRKGP GPSGLLPESWKPGMGGDPRGVGAGDMASAGPEGSVPCYPPPAPGEFPEAHSLHLSLLGVNYPLSPGLFSYLGPSLA AAAHVPFLASASPLLPPATAFPAVQPPQRPTPAPRLYYPLLLEHTLGLPAGKAALAKAPVSPRSPSGTPAPGLLKV PVPGLGPWPRVTPRDPGQEGELERAAQSDPRRRLSLGSRLELPKASPSLTRFCSRSSLPTGSSVMLWPEDGDPGGP ETPGPEGPLPLQPRGPVPGSPEHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQ AVRPPDAPLDLSVKRAPAKGPQALGEAWGRPELGPVLTGGTPEPPGMLGPAAPQPFSGHTTKCEADSSVPPPGLPL AAPDDPVIPGSGWGTCVATRSSQTPEAVCGLQSPQGAEV
GeneID:
283948
Add. information Mouse polyclonal antibody raised against a full-length human C16orf11 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C16orf11 (1 products)

Catalog No. Species Pres. Purity   Source  

C16orf11 Lysate

Western Blot: C16orf11 Lysate [NBL1-12577] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C16orf11
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn