discontinued

NBP1-94033 C16orf68 antibody

See related secondary antibodies

Search for all "C16orf68"

Quick Overview

Rabbit anti Human C16orf68

Product Description for C16orf68

Rabbit anti Human C16orf68.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C16orf68

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUU2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR
GeneID:
79091
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 79091

Accessory Products

Proteins and/or Positive Controls

Positive controls for C16orf68 (1 products)

Catalog No. Species Pres. Purity   Source  

METTL22 overexpression lysate

METTL22 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn