H00388284-B01P C16orf86 antibody

See related secondary antibodies

Search for all "C16orf86"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C16orf86

H00388284-B01P

Product Description for C16orf86

Mouse anti Human C16orf86.
Product is tested for Western blot / Immunoblot.

Properties for C16orf86

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZW13
Immunogen:
C16orf86 (AAI32881.1, 1 a.a. ~ 223 a.a) full-length human protein.
AA Sequence:
MVQRESLSSEGALGGKELQPRGWGTHHSRIPKSCTPAGRILVPSHYHHSPPVPQEPPCREQQESGSFRACRGLGSL ASKPLGPGVSLTRNGTGVEPWGCGQAGLFPGPGNGSQGWSLAQVSCPWLRSLSLPGLRAHLKAEAELPPKLPLQEE EPEDSQSEPSPSAKQHKKAKKRKSLGAPVLHAVASMVSAPLETLRLEREWQSLDCSFSPCLWGPTWHNLAL
GeneID:
388284
Add. information Mouse polyclonal antibody raised against a full-length human C16orf86 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C16orf86 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 16 open reading frame 86 (C16orf86)

Chromosome 16 open reading frame 86 (C16orf86) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C16orf86 (1 products)

Catalog No. Species Pres. Purity   Source  

C16orf86 overexpression lysate

C16orf86 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn