H00284083-B01P C17orf47 antibody

See related secondary antibodies

Search for all "C17orf47"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C17orf47

H00284083-B01P

Product Description for C17orf47

Mouse anti Human C17orf47.
Product is tested for Western blot / Immunoblot.

Properties for C17orf47

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ40121
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEP4
Immunogen:
C17orf47 (AAH22189.2, 1 a.a. ~ 570 a.a) full-length human protein.
AA Sequence:
MVKTNKPGAKVAVSAQRGSEVTTNTSPQQGHGYVLASSHRSAAVSLNPSHRRSEAAHPTTPHSASDYPRSVSLQSG PGHYAVPTPRGTETGPRTESSRHSSPHLKSQKTQTLASHASSRQWKVSPPREEAARRGSESKSGREVGHHASSIPD AKSTHQLSFQDQKNNLQSQILEDDPPSKVQNPQGVRVPRRILSYPKDEAVQTEPIQRITTTSEIRSPRSPSLLEHG SSCVSADYQTAQRRVPVEESETGPYGPIPSKPKALYRNMNLDSLLKLSVLKDSDGVHRVSARVDPESLHKYSAYPE TKPSAKVLVSSQVESNVRTPIRGNSEVGRRVTISPGVQSVEPTHHVTVPSVSEGSHKSSMFVTPEPIYKQQTQKPP EITYMSQGPTPRYPELSQKPSIHAELELTPRPLPPRSLPRYGPDSSWWPLLNPEVETPQSQLTTPDFEPKCSPSLD LLLSGFKIDSSPFCEDLKFQREKASLSPPSPPKEFPSWAPLSEVPQTPKHTCKQPIQRFTAFFLDVSEEMYNRVIW WLKGLCFSLLWAHCGSLGDGRTGEEWHLCIYRAGSFRR
GeneID:
284083
Add. information Mouse polyclonal antibody raised against a full-length human C17orf47 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf47 (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf47 overexpression lysate

C17orf47 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn