H00339263-B01P C17orf51 antibody

See related secondary antibodies

Search for all "C17orf51"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C17orf51

H00339263-B01P

Product Description for C17orf51

Mouse anti Human C17orf51.
Product is tested for Western blot / Immunoblot.

Properties for C17orf51

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ12977, FLJ31874, FLJ33618
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MQB3
Immunogen:
C17orf51 (XP_378661.1, 1 a.a. ~ 221 a.a) full-length human protein.
AA Sequence:
MGEKSRRKGPAPRHADGKLGRTCDHPYAPWSFTPSSRAPTAWVRPPCPVWASRLQEHSPEPRRARAPPTRRAQAAL YAPALRLRDHLDRFSILMTSCTSWLQAPQAPGLCRDEQSSRISVPQLSGAPILLPDLEGTKLSNFQESSPLPHKHE RKDKRSTPEEEGRSAPEKIIQSLKLCPGGHRPASLSSGCPAGCRLSFNLPPSMLLSVQKCCMPSSLKTC
GeneID:
339263
Add. information Mouse polyclonal antibody raised against a full-length human C17orf51 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf51 (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf51 overexpression lysate

C17orf51 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn