discontinued

NBP1-93828 C17orf76 antibody

See related secondary antibodies

Search for all "C17orf76"

Quick Overview

Rabbit anti Human C17orf76

Product Description for C17orf76

Rabbit anti Human C17orf76.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C17orf76

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NAA5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP
GeneID:
388341
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 388341

Accessory Products

Proteins and/or Positive Controls

Proteins for C17orf76 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 (transcript variant 1)

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 (transcript variant 2)

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C17orf76 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC75A overexpression lysate

LRRC75A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn