NBP1-93828 C17orf76 antibody

See related secondary antibodies

Search for all "C17orf76"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C17orf76

Product Description for C17orf76

Rabbit anti Human C17orf76.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C17orf76

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NAA5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP
GeneID:
388341
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 388341

Accessory Products

Proteins and/or Positive Controls

Proteins for C17orf76 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 (transcript variant 1)

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 (transcript variant 2)

Chromosome 17 open reading frame 76 (C17orf76), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for C17orf76 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC75A overexpression lysate

LRRC75A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn