H00055352-B01P C17orf79 antibody

See related secondary antibodies

Search for all "C17orf79"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C17orf79

H00055352-B01P

Product Description for C17orf79

Mouse anti Human C17orf79.
Product is tested for Western blot / Immunoblot.

Properties for C17orf79

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms COPR5, FLJ21119, HSA272196, TTP1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQ92
Immunogen:
C17orf79 (NP_060875.1, 1 a.a. ~ 184 a.a) full-length human protein.
AA Sequence:
MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSE EEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQELKPWVCCAPQGD MIYDPSWHHPPPLIPYYSKMVFETGQFDDAED
GeneID:
55352
Add. information Mouse polyclonal antibody raised against a full-length human C17orf79 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf79 (2 products)

Catalog No. Species Pres. Purity   Source  

C17orf79 Lysate

Western Blot: C17orf79 Lysate [NBL1-08245] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C17orf79 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

COPRS overexpression lysate

COPRS overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn