H00125228-B02P C18orf19 antibody

See related secondary antibodies

Search for all "C18orf19"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C18orf19

H00125228-B02P

Product Description for C18orf19

Mouse anti Human C18orf19.
Product is tested for Western blot / Immunoblot.

Properties for C18orf19

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms HsT2329, MGC24180
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96ND0
Immunogen:
C18orf19 (NP_689565.2, 1 a.a. ~ 272 a.a) full-length human protein.
AA Sequence:
MQWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGPQKQWLHLSAAQCVAKERRPLDAHPP QPGVLRHKQGKQHVSFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTF YYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPV KEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE
GeneID:
125228
Add. information Mouse polyclonal antibody raised against a full-length human C18orf19 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for C18orf19 (2 products)

Catalog No. Species Pres. Purity   Source  

C18orf19

C18orf19 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
10 µg / €380.00
  Abnova Taiwan Corp.

C18orf19

C18orf19 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
25 µg / €510.00
  Abnova Taiwan Corp.

Positive controls for C18orf19 (2 products)

Catalog No. Species Pres. Purity   Source  

FAM210A overexpression lysate

FAM210A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

FAM210A overexpression lysate

FAM210A overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn