NBP1-94061 C18orf63 antibody

See related secondary antibodies

Search for all "C18orf63"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C18orf63

NBP1-94061

More Views

  • NBP1-94061

Product Description for C18orf63

Rabbit anti Human C18orf63.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for C18orf63

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68DL7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ERHSILSNWCYVLPSMKMGQIINIFHAIPAACPFHSYGDFQRHWDALYGYKLPGDCGKIKIYCNIYFKMLGERTFTYPLSCIRSQPMQF
GeneID:
644041
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 644041

Accessory Products

  • LinkedIn