NBP1-94063 C19orf12 antibody

See related secondary antibodies

Search for all "C19orf12"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C19orf12

Product Description for C19orf12

Rabbit anti Human C19orf12.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C19orf12

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NSK7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
GeneID:
83636
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 83636

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf12 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 19 open reading frame 12 (C19orf12), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag, transcript variant 2)

Chromosome 19 open reading frame 12 (C19orf12), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C19orf12 (2 products)

Catalog No. Species Pres. Purity   Source  

C19orf12 overexpression lysate

C19orf12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C19orf12 overexpression lysate

C19orf12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn