discontinued

NBP1-94063 C19orf12 antibody

See related secondary antibodies

Search for all "C19orf12"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human C19orf12

Product Description for C19orf12

Rabbit anti Human C19orf12.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C19orf12

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NSK7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
GeneID:
83636
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 83636

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf12 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 19 open reading frame 12 (C19orf12), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag, transcript variant 2)

Chromosome 19 open reading frame 12 (C19orf12), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C19orf12 (2 products)

Catalog No. Species Pres. Purity   Source  

C19orf12 overexpression lysate

C19orf12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

C19orf12 overexpression lysate

C19orf12 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn