H00126074-B01P C19orf39 antibody

See related secondary antibodies

Search for all "C19orf39"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human C19orf39

H00126074-B01P

Product Description for C19orf39

Mouse anti Human C19orf39.
Product is tested for Western blot / Immunoblot.

Properties for C19orf39

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ35119, MGC149562, MGC78620
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NVH7
Immunogen:
C19orf39 (AAH68071.1, 1 a.a. ~ 229 a.a) full-length human protein.
AA Sequence:
MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELF RLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDV LHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQ P
GeneID:
126074
Add. information Mouse polyclonal antibody raised against a full-length human C19orf39 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for C19orf39 (1 products)

Catalog No. Species Pres. Purity   Source  

SWSAP1 overexpression lysate

SWSAP1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn