NBP1-81210 C19orf48 antibody

See related secondary antibodies

Search for all "C19orf48"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C19orf48

Product Description for C19orf48

Rabbit anti Human C19orf48.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C19orf48

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6RUI8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
GeneID:
84798
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84798

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf48 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 19 open reading frame 48 (C19orf48), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 19 open reading frame 48 (C19orf48), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Chromosome 19 open reading frame 48 (C19orf48), with N-terminal HIS tag, expressed in E.Coli, 50ug (N-term HIS tag)

Chromosome 19 open reading frame 48 (C19orf48), with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C19orf48 (2 products)

Catalog No. Species Pres. Purity   Source  

C19orf48 Lysate

Western Blot: C19orf48 Lysate [NBL1-08273] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C19orf48 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

C19orf48 Lysate

Western Blot: C19orf48 Lysate [NBL1-08274] - Western Blot experiments. Left-Control; Right -Over-expression Lysate Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn