discontinued

NBP1-81210 C19orf48 antibody

See related secondary antibodies

Search for all "C19orf48"

Quick Overview

Rabbit anti Human C19orf48

Product Description for C19orf48

Rabbit anti Human C19orf48.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for C19orf48

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6RUI8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
GeneID:
84798
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 84798

Accessory Products

Proteins and/or Positive Controls

Proteins for C19orf48 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 19 open reading frame 48 (C19orf48), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag)

Chromosome 19 open reading frame 48 (C19orf48), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Chromosome 19 open reading frame 48 (C19orf48), with N-terminal HIS tag, expressed in E.Coli, 50ug (N-term HIS tag)

Chromosome 19 open reading frame 48 (C19orf48), with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for C19orf48 (2 products)

Catalog No. Species Pres. Purity   Source  

C19orf48 Lysate

Western Blot: C19orf48 Lysate [NBL1-08273] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C19orf48 Protein
  Novus Biologicals Inc.

C19orf48 Lysate

Western Blot: C19orf48 Lysate [NBL1-08274] - Western Blot experiments. Left-Control; Right -Over-expression Lysate Protein
  Novus Biologicals Inc.
  • LinkedIn